English site

CDS : ACP_3099

CDS Description

CDSACP_3099
Product nameacyl carrier protein phosphodiesterase
Gene name
ContigCP001472
location3586905..3587525
NBRC No.15755
MicrobeAcidobacterium capsulatum
Current status
>ACP_3099 acyl carrier protein phosphodiesterase
LLTLLRLDSSPLETSVSRALTDEFVAAWKAAHPDGVVIVRDLTLAPPPPVDAVWIGACFT
PPPQRTAEQNDRLALSDAFLEELERADEYAIGVAMHNFSIPAVLKLWIDQVVRVGRTFAY
SDGRPQGLLQGKKATILAATGGVYSAGTPAEGMNFLDPYLKTVLGFLGVRDIQVVTAGGT
SQLRNPDVDREAFLEPVLQRVRETAA


>ACP_3099 acyl carrier protein phosphodiesterase
TTGTTGACCCTGCTTCGTCTGGATTCGAGTCCGCTGGAAACCTCTGTCAGCCGCGCGCTG
ACGGACGAATTTGTCGCCGCCTGGAAAGCTGCCCACCCTGATGGGGTGGTGATTGTGCGC
GATCTGACGCTGGCTCCGCCGCCGCCGGTCGACGCCGTGTGGATCGGCGCCTGCTTCACT
CCGCCGCCGCAGCGCACTGCCGAGCAGAACGACAGGCTCGCGCTTTCGGATGCATTCCTG
GAGGAACTGGAGCGCGCCGACGAATATGCGATTGGCGTGGCCATGCATAACTTTTCCATT
CCCGCGGTGCTCAAGCTGTGGATCGATCAGGTGGTTCGCGTGGGACGCACCTTTGCCTAC
TCTGATGGCCGGCCGCAGGGCTTGCTTCAGGGGAAAAAGGCGACCATACTGGCGGCGACC
GGTGGAGTCTACTCCGCAGGCACGCCGGCGGAGGGAATGAATTTTCTCGATCCCTACTTG
AAAACGGTTCTGGGCTTTCTGGGAGTGCGGGACATCCAGGTGGTCACGGCGGGCGGCACA
TCGCAGCTACGCAATCCGGATGTGGACCGGGAGGCTTTTCTTGAGCCCGTTCTGCAACGG
GTTCGCGAGACGGCCGCCTGA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)