English site

CDS : AZC_1287

CDS Description

CDSAZC_1287
Product nameacyl carrier protein phosphodiesterase
Gene name
ContigNC_009937
location1440545..1441165
NBRC No.14845
MicrobeAzorhizobium caulinodans
Current status
>AZC_1287 acyl carrier protein phosphodiesterase
MTSILLVTSSPRGADSLSTRFATEIAEGLKARFGGALLTRDLAANPPPHITQAYIHGRVT
PPEARTPEQVEAVALAQEFVDEVKAADVIVLGSGMINFGPSSQLKAWFDHITWPGVTFGY
GEAGRPQGTLTGKKVYLVTAAGGVFSEGDWAPFDFQTGNLRHLLGFVGLTDVEIIRVEGT
VFGPEAAKAAIAATEAQVRSILETAA


>AZC_1287 acyl carrier protein phosphodiesterase
ATGACCAGCATCCTCCTCGTGACGTCCAGCCCTCGGGGCGCCGATAGCCTGTCTACCCGT
TTCGCGACCGAGATCGCCGAAGGCCTCAAGGCACGTTTTGGCGGCGCGCTACTGACGCGC
GATCTGGCGGCCAACCCGCCGCCGCATATCACGCAGGCCTATATTCACGGCCGCGTCACG
CCGCCGGAGGCACGCACGCCCGAGCAGGTCGAGGCGGTCGCCCTTGCCCAGGAGTTCGTC
GATGAGGTGAAGGCCGCCGACGTGATCGTCTTGGGTTCGGGCATGATCAATTTCGGCCCG
TCTTCGCAGCTCAAGGCTTGGTTCGATCATATCACTTGGCCGGGTGTGACCTTCGGGTAT
GGCGAAGCGGGCAGGCCGCAGGGAACGCTGACCGGCAAGAAGGTCTATCTCGTCACCGCT
GCGGGCGGTGTCTTTTCGGAAGGCGACTGGGCGCCCTTTGATTTCCAGACCGGCAATCTG
CGCCACCTCTTGGGCTTCGTCGGCCTGACCGACGTCGAAATCATCCGCGTGGAAGGCACC
GTCTTCGGGCCCGAGGCGGCCAAGGCCGCCATCGCCGCCACCGAAGCCCAAGTGCGCTCG
ATCCTGGAAACGGCCGCCTGA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)