English site

CDS : BAMF_0457

CDS Description

CDSBAMF_0457
Product nameacyl carrier protein phosphodiesterase 3; NAD(P)H dehydrogenase
Gene name
ContigFN597644
location491378..492028
NBRC No.15535
MicrobeBacillus amyloliquefaciens
Current status
>BAMF_0457 acyl carrier protein phosphodiesterase 3; NAD(P)H dehydrogenase
MSKTLIINAHPKVDDASSYSLQVMNRFLETYKELIPKSEELEQINLYSDEVPMIDKTVLS
AWEKAGKGDELTSDEQKVTERMTEVLKQFKSAKTYVIVLPLHNFNIPSKLKDYMDNIMIA
RETFKYTDTGSVGLLNDGRRMLVIQASESIYTNDDWYEEVEYSNKYLKSMFNFLGIEDYQ
IIRVQGTALLSLEDVLQKAKKEVEEAASRLAGKRKA


>BAMF_0457 acyl carrier protein phosphodiesterase 3; NAD(P)H dehydrogenase
ATGAGCAAAACACTTATCATTAACGCACATCCGAAAGTAGATGATGCATCATCATACAGT
TTGCAGGTAATGAACCGCTTTTTGGAAACTTACAAAGAATTAATTCCAAAGAGTGAAGAG
CTTGAGCAGATTAACTTGTATAGTGATGAAGTGCCTATGATTGATAAAACAGTTTTAAGC
GCATGGGAAAAGGCAGGAAAAGGCGATGAACTGACTAGCGATGAACAAAAAGTAACGGAG
CGTATGACAGAAGTATTGAAACAATTTAAAAGTGCAAAAACGTATGTCATCGTTTTGCCA
TTGCATAATTTCAATATTCCATCAAAATTAAAAGACTACATGGACAATATCATGATCGCA
CGTGAAACATTTAAATATACTGACACTGGGTCAGTGGGTCTGCTTAATGATGGACGAAGA
ATGCTTGTCATACAAGCTAGCGAATCAATTTATACAAATGATGATTGGTATGAAGAAGTT
GAATACTCTAATAAATATTTGAAATCAATGTTCAATTTCCTCGGTATTGAGGATTATCAA
ATTATACGAGTGCAAGGAACAGCTTTACTAAGTCTGGAGGATGTTTTACAAAAAGCAAAG
AAAGAAGTTGAAGAAGCTGCTTCAAGATTAGCAGGGAAAAGGAAAGCCTGA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)