English site

CDS : BAMF_1992

CDS Description

CDSBAMF_1992
Product nameAcyl carrier protein phosphodiesterase
Gene name
ContigFN597644
location2097394..2098020
NBRC No.15535
MicrobeBacillus amyloliquefaciens
Current status
>BAMF_1992 Acyl carrier protein phosphodiesterase
MSQVLFVKSSDRTAEEGVSVKLYEAFLAAYKENNPNDEVIELDLHNENLPYLGRDMINGT
FKASKGIEMTDEEKKQASTADIYLNQFVKADKVVFAFPLWNFTVPAVLHTYVDYLSRAGV
TFTYTPEGPKGLMGDKKVALLNARGGVYSEGPMASLEMSLNFMKTVLGFWGVQDLHTVVV
EGHNAAPDNAQAIIEKGLQEAKDLAAKF


>BAMF_1992 Acyl carrier protein phosphodiesterase
ATGTCTCAAGTATTATTTGTAAAATCAAGTGACCGTACGGCTGAAGAAGGCGTATCCGTA
AAATTATACGAAGCGTTTTTGGCTGCTTATAAAGAAAACAATCCGAATGATGAAGTGATC
GAACTTGATCTTCATAATGAAAACCTTCCTTACCTCGGAAGAGATATGATTAACGGAACA
TTCAAAGCTTCAAAAGGAATTGAAATGACAGACGAAGAGAAAAAACAAGCATCAACTGCT
GACATTTACTTAAACCAATTCGTCAAAGCTGACAAAGTTGTGTTTGCATTCCCGCTTTGG
AACTTCACAGTGCCTGCTGTGCTTCATACTTATGTTGATTACCTGTCTCGCGCAGGGGTT
ACTTTCACATACACGCCTGAAGGGCCTAAAGGTTTGATGGGGGATAAAAAAGTAGCACTC
TTAAATGCACGCGGCGGCGTATATTCTGAAGGACCGATGGCATCTCTTGAAATGTCATTA
AACTTCATGAAAACCGTTCTCGGCTTCTGGGGAGTTCAAGATCTGCACACTGTTGTCGTT
GAAGGCCATAACGCCGCACCGGATAACGCTCAAGCGATCATTGAAAAAGGACTGCAAGAA
GCGAAAGATCTGGCTGCAAAATTCTAA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)