English site

CDS : CA_C3421

CDS Description

CDSCA_C3421
Product nameAcyl carrier protein phosphodiesterase
Gene name
ContigNC_003030
location3607120..3607722
NBRC No.13948
MicrobeClostridium acetobutylicum
Current status
>CA_C3421 Acyl carrier protein phosphodiesterase
MSKVLYIKANAKPEGVSRTFKISDSFIEEYRNQKPNDEIITLDLYKEGISFLTEEAIKLH
VPKQGEGKDHHVLKYAYQFAEADKYVIAAPFWNLSFPAILKAYIDYICVTGITFKYTEEG
AVGLCQGKKAVHIVSRGGGYSEGPFEMYEMGDRYLRTIFGFLGITDFTTIVAEKLDVVGE
DVEGILRNTIEKAKEQAKEF


>CA_C3421 Acyl carrier protein phosphodiesterase
ATGAGTAAGGTATTATATATTAAGGCAAATGCGAAACCAGAGGGAGTTTCTAGGACATTT
AAAATATCTGACAGTTTTATTGAGGAATACAGAAATCAAAAACCTAATGATGAAATTATA
ACACTAGACTTATATAAAGAAGGAATAAGCTTTTTAACAGAAGAGGCTATAAAGCTTCAT
GTTCCAAAGCAGGGAGAAGGTAAGGACCATCATGTTTTAAAATATGCATATCAATTTGCA
GAAGCTGATAAATATGTAATTGCAGCGCCATTTTGGAATTTAAGTTTTCCAGCCATATTA
AAGGCGTACATTGATTATATATGTGTTACAGGTATTACTTTTAAGTATACAGAAGAAGGA
GCAGTTGGACTATGTCAGGGGAAAAAAGCAGTTCATATAGTTTCTAGAGGTGGTGGATAT
TCAGAAGGGCCATTTGAAATGTATGAAATGGGAGATAGATACTTACGAACAATATTTGGA
TTTTTGGGTATAACTGATTTTACAACTATAGTAGCAGAAAAGTTGGATGTTGTAGGTGAA
GATGTAGAAGGAATTTTGAGAAATACAATTGAAAAGGCAAAAGAGCAGGCAAAAGAATTT
TAG


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)