English site

CDS : CV_2016

CDS Description

CDSCV_2016
Product name[acyl-carrier-protein] phosphodiesterase
Gene nameacpD
ContigAE016825
location2197838..2198446
NBRC No.12614
MicrobeChromobacterium violaceum
Current status
>CV_2016 [acyl-carrier-protein] phosphodiesterase
MKLLHLDSSILADNSVTRELSAVVADTLRQRHANVETSYRDLAANPIAHLSGEIVGARFA
PESDWTATQRSEAALSEQLIEEFIAADVLVIGAPMYNFSIPTQLKSWIDRVAAAGRTFKY
TENGPVGLVPNKKVVLVSARGGVHSGEQGSLMDFQEDYVVKVLGFLGVSDVEIIRAEAIG
MGPDKRATSIHLAKEAIAKLAL


>CV_2016 [acyl-carrier-protein] phosphodiesterase
ATGAAACTGCTCCACCTCGACTCCAGCATCCTTGCCGACAACTCCGTGACCCGCGAACTG
TCCGCCGTCGTCGCCGACACCCTGCGCCAGCGCCACGCCAATGTGGAAACCAGCTATCGC
GACCTGGCCGCCAACCCGATCGCCCACCTGTCCGGCGAGATCGTCGGCGCGCGTTTCGCC
CCCGAGTCCGACTGGACCGCGACCCAGCGCAGCGAAGCCGCGCTCAGCGAGCAACTGATC
GAGGAATTCATCGCCGCCGACGTGCTGGTGATCGGCGCGCCGATGTACAACTTCTCGATC
CCGACGCAGCTGAAGAGCTGGATCGATCGCGTGGCCGCCGCCGGCCGCACTTTCAAATAC
ACCGAGAACGGCCCGGTGGGCCTGGTGCCGAACAAGAAGGTGGTGCTGGTGTCCGCTCGC
GGCGGCGTGCACAGCGGCGAGCAGGGCAGCCTGATGGACTTTCAGGAGGATTACGTTGTG
AAGGTGCTGGGTTTCCTGGGCGTCAGCGACGTGGAGATCATCCGCGCCGAAGCCATCGGC
ATGGGCCCGGACAAGCGCGCCACTTCCATCCACCTGGCCAAGGAGGCCATCGCCAAGTTG
GCGCTGTAA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)