English site

CDS : EHR_02160

CDS Description

CDSEHR_02160
Product nameacyl carrier protein
Gene name
ContigCP003504
location405144..405764
NBRC No.3181
MicrobeEnterococcus hirae
Current status
>EHR_02160 acyl carrier protein
MASVLVVKGHPLTAQESRSVKALTTFLTSYKENHPEDEVTVLELYRDDIPEIDEELLSGW
EALRAGAEFSTLSESQQQKIARFNELTDQFLAADKIVIANALWNLNIPTKLKAWFDTVNV
AGKTFRYTENGPEGLVSGKKALHIQSNGGIYNGQDFASQYVKGILNFVGIDQVDQLFIEG
IDYTPDRAEELMQSALDKAAAFGQTF


>EHR_02160 acyl carrier protein
ATGGCATCAGTTTTAGTAGTAAAAGGGCACCCATTAACTGCACAGGAATCACGTTCAGTT
AAAGCATTAACAACTTTTTTAACTAGTTACAAAGAAAATCATCCGGAAGATGAAGTGACT
GTTTTAGAGCTTTATCGTGATGATATCCCAGAAATCGATGAAGAATTACTTTCAGGATGG
GAAGCACTTCGGGCAGGTGCTGAGTTCTCTACTTTGTCTGAAAGTCAACAACAAAAAATT
GCTCGTTTCAATGAATTGACCGACCAATTTCTTGCTGCAGACAAGATCGTTATTGCAAAT
GCTTTATGGAACTTGAATATCCCAACAAAATTAAAAGCTTGGTTTGACACCGTCAATGTC
GCTGGCAAGACATTCCGTTATACTGAAAACGGACCAGAAGGATTAGTTTCTGGTAAAAAA
GCTTTGCACATCCAATCCAACGGAGGCATTTATAACGGTCAAGACTTCGCTTCTCAATAT
GTCAAAGGCATCTTGAACTTTGTCGGTATCGATCAAGTGGATCAATTATTTATTGAAGGT
ATCGACTATACCCCTGACCGTGCAGAAGAATTGATGCAATCAGCTTTAGATAAAGCTGCA
GCATTTGGTCAAACGTTCTAA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)