English site

CDS : HELO_3883

CDS Description

CDSHELO_3883
Product name(acyl-carrier protein) phosphodiesterase
Gene name
ContigFN869568
location3380560..3381162
NBRC No.15536
MicrobeHalomonas elongata
Current status
>HELO_3883 (acyl-carrier protein) phosphodiesterase
MTTRVLVLTSSILDGNSLALAEHFKAQLAGRDDVAITTRNLIADELPHLGLPELSSWQVP
AGERTPEQRELAARSDALIDELQAHDVLVLAVPLYNLGIPSQMKAWFDRILRAGVTFRYT
ENGPQGLVEGKRAMILAARGGQYAGTELDSQTPHLKHMLGLIGITEVDTVFAEGLAMGEE
LHEAAMGEARQAIEGLAERL


>HELO_3883 (acyl-carrier protein) phosphodiesterase
ATGACCACTCGCGTTCTCGTTCTGACGTCTTCCATCCTCGATGGCAATTCCCTGGCACTG
GCCGAGCACTTCAAGGCTCAGCTTGCCGGGCGTGACGATGTTGCCATCACCACGCGCAAC
TTGATCGCCGATGAGCTGCCCCACCTGGGGCTGCCGGAGCTTTCCAGCTGGCAGGTGCCG
GCAGGCGAGCGCACGCCCGAGCAGCGTGAACTGGCGGCGCGTTCCGACGCCTTGATCGAT
GAGCTCCAGGCGCATGATGTCCTGGTGCTGGCGGTGCCGCTCTACAATCTGGGCATTCCG
TCACAGATGAAGGCCTGGTTCGACCGCATCCTGCGGGCCGGCGTCACCTTCCGCTATACC
GAGAATGGGCCCCAGGGTTTGGTCGAGGGTAAGCGGGCAATGATTCTCGCGGCGCGGGGC
GGCCAGTATGCCGGCACCGAGCTCGACAGCCAGACGCCGCATCTCAAGCACATGCTCGGC
CTGATCGGTATCACCGAGGTCGATACCGTGTTTGCCGAGGGGCTGGCCATGGGCGAGGAG
CTGCATGAAGCGGCCATGGGCGAGGCGCGTCAGGCGATCGAGGGATTGGCGGAACGCCTC
TGA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)