English site

CDS : HLPCO_001663

CDS Description

CDSHLPCO_001663
Product nameFMN-dependent NADH-azoreductase 1 protein
Gene nameazoR1
ContigAFNU02000005
location20267..20911
NBRC No.Not assigned
MicrobeHaloplasma contractile
Current status
>HLPCO_001663 FMN-dependent NADH-azoreductase 1 protein
MMKTLLYITCNSKPETLSASKTVGRELVEEFLKANTDYRLNEVDLYEMKLPRLKYKYFEN
RNKLIGQEAYNKLTEEDQKEVDRIKELAIEFKNADCYVIATPMWSILFPAPLKEYLDCII
QNDITIKISRERVEGLLDDKKRSMVYIQSSGGSIPLLLDKKMNHGGNYIKDIFKFLGIKD
FHEVLVDGTGFTEEEEHKAVEKGKKDVQKLVKNL


>HLPCO_001663 FMN-dependent NADH-azoreductase 1 protein
ATGATGAAAACATTACTTTATATAACTTGTAACTCTAAACCAGAGACTCTTTCTGCTAGT
AAAACAGTAGGGAGAGAATTAGTTGAAGAATTTCTAAAGGCAAATACTGATTATAGATTA
AATGAAGTTGATCTTTACGAGATGAAACTTCCGAGATTAAAGTATAAGTATTTCGAGAAT
CGAAACAAGTTAATTGGACAGGAAGCCTATAATAAGCTCACAGAAGAGGATCAAAAAGAG
GTAGACAGAATTAAAGAATTAGCAATTGAATTTAAAAATGCAGATTGTTACGTTATAGCT
ACCCCAATGTGGAGTATCTTATTTCCTGCGCCTCTAAAGGAATACTTAGATTGTATCATT
CAAAACGATATTACAATTAAGATAAGCAGAGAGAGAGTTGAGGGATTATTAGATGATAAA
AAACGATCTATGGTTTATATTCAATCATCTGGTGGCTCGATTCCCTTGCTTTTAGATAAA
AAAATGAATCATGGAGGAAATTATATAAAAGATATTTTTAAATTCTTAGGTATAAAAGAT
TTTCATGAAGTTTTAGTAGATGGAACAGGATTTACTGAAGAGGAAGAACATAAGGCAGTT
GAGAAGGGGAAGAAAGACGTTCAAAAATTGGTTAAGAACTTATAG


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)