English site

CDS : HLPCO_002005

CDS Description

CDSHLPCO_002005
Product nameFMN-dependent NADH-azoreductase 2 protein
Gene nameazoR2
ContigAFNU02000006
location175368..175970
NBRC No.Not assigned
MicrobeHaloplasma contractile
Current status
>HLPCO_002005 FMN-dependent NADH-azoreductase 2 protein
MYRKILYIKANPKPEEDSYTFKLANEFLKYYKQENPDDQITELDLYKEGIKCLDQKMLKE
LSDKERNEMHRHALQFAKSDKYIIAAPMWNLSVPAILKAYFDYVSYAGITFKYTEKGPMG
LLGDKPRRVMHIVSRGGQYSEGPYKAFEMGDEYVRTILGFMGIIKVETLALENTNVLNGN
ELHEKVREAYKEAKRMGKHF


>HLPCO_002005 FMN-dependent NADH-azoreductase 2 protein
ATGTATAGAAAAATATTGTATATAAAAGCAAACCCAAAACCAGAAGAAGACTCTTACACG
TTTAAATTAGCAAATGAATTCTTAAAATATTACAAGCAAGAAAATCCAGATGATCAAATA
ACTGAGCTAGATTTATATAAAGAAGGAATTAAATGTCTTGATCAAAAGATGTTAAAAGAG
TTATCAGATAAAGAGAGGAACGAAATGCATCGTCATGCCTTACAGTTTGCTAAATCAGAT
AAATATATAATAGCAGCGCCTATGTGGAATTTATCTGTTCCTGCAATTCTAAAGGCTTAT
TTTGATTATGTTTCATATGCTGGTATAACGTTCAAGTATACGGAAAAAGGACCAATGGGA
CTCCTTGGAGACAAACCTAGACGTGTGATGCATATTGTGAGTCGCGGTGGTCAATATAGT
GAGGGACCTTATAAAGCATTTGAAATGGGTGATGAGTATGTGCGCACAATATTAGGGTTT
ATGGGTATTATAAAAGTAGAAACCTTGGCTTTAGAAAACACAAATGTGTTAAATGGCAAT
GAGTTACATGAAAAAGTTAGAGAAGCTTATAAAGAGGCAAAAAGAATGGGAAAACATTTT
TAG


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)