English site

CDS : HLPCO_002390

CDS Description

CDSHLPCO_002390
Product nameFMN-dependent NADH-azoreductase 2 protein
Gene name
ContigAFNU02000010
location5565..6158
NBRC No.Not assigned
MicrobeHaloplasma contractile
Current status
>HLPCO_002390 FMN-dependent NADH-azoreductase 2 protein
MTKVLYIKANPKPDTESNTFKLANEFIDEYKRLNKEDEVKVLDLYKENVTFLDGEQLEKM
FGGQDNIMIEYAKQFKEFDKYVFAAPMWNLSIPAILKAYFDYITYVGVTFNYTEQGPVGL
LENKKAMHVVTRGGNYSEGPAASFELGDKYVRTILTFMGVKDISTLKLENTNVLMGDELK
QAINKAKEDAKKMAKEF


>HLPCO_002390 FMN-dependent NADH-azoreductase 2 protein
ATGACAAAAGTATTATATATTAAAGCAAATCCAAAACCTGATACAGAGTCTAACACGTTT
AAATTAGCAAATGAATTTATTGATGAGTATAAACGCCTTAATAAAGAGGATGAAGTTAAA
GTACTCGATTTATACAAAGAAAACGTCACTTTCCTCGATGGTGAACAATTAGAAAAGATG
TTTGGTGGACAAGACAATATCATGATTGAGTACGCTAAACAATTTAAAGAGTTTGATAAA
TATGTATTTGCTGCTCCTATGTGGAACTTAAGTATTCCTGCTATACTAAAAGCATACTTT
GATTACATCACATATGTTGGCGTTACCTTTAACTATACGGAACAAGGTCCTGTTGGACTA
TTAGAAAATAAAAAAGCAATGCACGTTGTAACACGCGGTGGTAATTATAGTGAAGGCCCT
GCTGCTAGTTTTGAACTAGGCGATAAATATGTAAGGACAATCTTAACGTTCATGGGTGTA
AAGGATATTAGTACATTAAAATTAGAAAATACAAACGTTCTAATGGGAGACGAGTTAAAA
CAAGCAATAAATAAAGCAAAAGAAGACGCAAAAAAAATGGCAAAAGAATTTTAA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)