English site

CDS : HMPREF0531_11156

CDS Description

CDSHMPREF0531_11156
Product nameflavodoxin-like protein
Gene name
ContigACGZ02000008
location227764..228429
NBRC No.15891
MicrobeLactobacillus plantarum subsp. plantarum
Current statusImproved High-Quality Draft
>HMPREF0531_11156 flavodoxin-like protein
MLLVNKIKELFKMTKLLMINAHPHTTVPSASLTVAASFKTAYQQTHPNDEITTRDLYQDG
VPALNDTTFEAWRKQKYGEELTSVEAELLSRHAAWLAEFLAADKIVFVNPMYNHFLPAEL
KQYLDLTAVARKTFKYTVNGPVGLLPDKHVLHIQAAGGYYHQPDQHNQVEAGDPYLRGMM
QLYGIQDYRTIFIEGLDQFPEQREQAITAAQVAAEKLAGEF


>HMPREF0531_11156 flavodoxin-like protein
ATGTTGCTTGTCAACAAAATTAAGGAGCTGTTTAAAATGACAAAATTATTAATGATTAAT
GCTCATCCACACACGACCGTCCCCAGTGCCTCACTGACCGTTGCAGCGAGTTTTAAAACT
GCGTATCAGCAAACCCATCCGAACGATGAGATTACGACACGCGATCTTTATCAGGACGGC
GTTCCCGCTTTGAACGACACAACCTTCGAAGCTTGGCGTAAACAAAAATACGGTGAAGAA
CTAACGTCAGTGGAAGCTGAACTACTTAGCCGTCACGCCGCCTGGCTAGCTGAATTTCTA
GCAGCCGACAAGATCGTCTTCGTTAATCCAATGTACAATCACTTTCTTCCAGCCGAACTC
AAACAATACTTAGACTTAACCGCAGTCGCCCGTAAAACTTTTAAGTACACGGTCAACGGC
CCGGTCGGCTTATTACCCGACAAACACGTCTTACACATTCAGGCTGCGGGTGGCTACTAT
CACCAACCTGATCAGCACAACCAGGTTGAAGCAGGCGACCCCTACCTCCGTGGCATGATG
CAACTGTATGGGATTCAGGATTACCGAACCATCTTCATTGAAGGATTGGACCAATTTCCA
GAACAGCGAGAACAGGCCATCACTGCCGCACAGGTAGCAGCAGAAAAACTCGCCGGTGAA
TTTTAA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)