English site

CDS : HNE_0965

CDS Description

CDSHNE_0965
Product nameacyl carrier protein phosphodiesterase
Gene name
ContigCP000158
location978966..979592
NBRC No.14232
MicrobeHyphomonas neptunium
Current status
>HNE_0965 acyl carrier protein phosphodiesterase
MSNLLVLNSSANTGESVSRILIDEAVNQILTAAPGTDVVRRDLGANPVPHLTTANLAGVR
GTPSTSEELAARALSDELIAELKAAGTVIIAAPMYNFSVPTSLRSWFDFVLRAGETFKYS
EAGPEGLLKGKKVVVLTSRGGLYSEGPAAAADFQEPYLRHLLGFVGITDVTFIHAEKIGF
GPEARAAAITGAKGQIAKVAQTFSTVAA


>HNE_0965 acyl carrier protein phosphodiesterase
ATGTCCAATCTTCTCGTTCTCAATTCCAGCGCCAATACCGGCGAATCTGTTTCCCGCATC
CTGATCGACGAAGCGGTAAACCAGATCCTCACAGCTGCGCCCGGCACAGATGTTGTGCGC
CGCGACCTTGGCGCCAATCCTGTCCCCCACCTCACCACGGCAAACCTTGCCGGCGTGCGC
GGCACCCCGTCCACGTCTGAGGAGCTCGCTGCCCGCGCGCTGTCTGATGAGCTGATCGCC
GAGCTGAAAGCTGCCGGCACCGTCATCATCGCCGCGCCGATGTACAACTTCTCCGTCCCT
ACCAGCCTGCGGTCCTGGTTCGACTTCGTGCTGCGCGCCGGTGAAACCTTCAAATACTCC
GAGGCCGGCCCCGAAGGTCTGCTGAAAGGCAAGAAGGTCGTCGTGCTCACCTCGCGCGGC
GGTCTCTATTCGGAAGGCCCTGCCGCCGCCGCTGACTTCCAGGAGCCTTACCTGCGCCAC
CTGCTCGGCTTTGTCGGCATCACGGACGTCACCTTCATCCACGCCGAAAAGATCGGCTTT
GGCCCCGAGGCCCGCGCCGCCGCCATCACCGGCGCGAAGGGCCAGATTGCCAAAGTCGCC
CAGACCTTCTCCACGGTCGCTGCCTGA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)