English site

CDS : I588_01391

CDS Description

CDSI588_01391
Product namehypothetical protein
Gene name
ContigASWD01000002
location49830..50450
NBRC No.100697
MicrobeEnterococcus pallens
Current status
>I588_01391 hypothetical protein
MAKVLVVKAHPLTNEDSQTLTVLDAFISAYQSEHPEDIVDIVDLFQVSLPEIDQDLLMAW
KELSQGKEFTDLGSDQQEKVRLFNDFTEQFLASDKIVIANALWNLNIPTRLKAWFDTVNV
AGKTFKYTAEGPVGLTEGKKALHIQSSGGVYDGKDFSAMYVKEMLKFVGVTDFSAVYIEG
ADYDPNQRTAIVDAAKEKAVEIAKNF


>I588_01391 hypothetical protein
ATGGCAAAAGTACTAGTTGTGAAAGCGCACCCGCTCACAAATGAAGATTCACAAACACTA
ACTGTGTTAGATGCATTTATTTCAGCTTATCAATCAGAACATCCTGAGGATATTGTCGAC
ATTGTTGATTTATTTCAAGTAAGTCTACCGGAGATTGATCAAGATTTATTAATGGCTTGG
AAAGAACTAAGTCAAGGTAAAGAGTTCACAGATTTGGGTTCAGACCAACAAGAAAAAGTT
CGCTTATTCAATGATTTCACCGAACAATTCTTAGCTAGTGATAAAATTGTCATTGCAAAT
GCCTTGTGGAACTTGAATATTCCAACCCGTTTAAAAGCATGGTTTGATACTGTTAACGTG
GCAGGCAAAACATTCAAGTATACAGCAGAAGGCCCTGTTGGTTTAACAGAGGGTAAAAAG
GCCTTGCATATTCAATCCAGCGGCGGTGTTTACGATGGAAAAGATTTTTCAGCGATGTAT
GTAAAAGAAATGCTGAAATTTGTTGGTGTTACTGACTTCTCAGCTGTTTACATTGAAGGT
GCAGACTATGATCCTAATCAACGTACTGCTATTGTAGATGCAGCAAAAGAAAAAGCCGTT
GAAATTGCTAAAAACTTTTAA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)