English site

CDS : I589_03286

CDS Description

CDSI589_03286
Product namehypothetical protein
Gene name
ContigASWE01000004
location483191..483829
NBRC No.100711
MicrobeEnterococcus phoeniculicola
Current status
>I589_03286 hypothetical protein
MKTLLINAHPDFKQTDSYSAKLQQVFLAAFHKRFPSAHLTYLTLYDTMIPRIEENQLLRV
WEKQQKHELLTSSEEVIAKTSSDLLAQFKEHHRIVIVSPLHNFNVSSRLKDYIDNILIAR
ETFKYTDTGSVGLMTDDYRLLYLQASGSVYTNNDRYTPLEFSHYFLKEMFTEIMGFEKFY
IVRAQGTALYSADEVLKFLPEEMEATVNQFYD


>I589_03286 hypothetical protein
ATGAAAACATTATTGATTAATGCACATCCCGATTTTAAACAAACAGACAGCTATTCAGCT
AAATTACAGCAGGTGTTCTTAGCAGCTTTCCACAAGAGATTTCCTAGTGCGCATCTCACT
TATCTAACACTTTACGATACCATGATTCCAAGAATTGAGGAAAATCAGCTCTTAAGAGTT
TGGGAAAAGCAACAAAAACATGAGTTACTGACTTCTTCTGAGGAAGTAATTGCAAAAACT
TCCTCAGATTTACTTGCTCAATTTAAAGAGCATCATCGAATAGTTATCGTTTCTCCATTG
CACAATTTCAATGTTTCTTCACGACTAAAAGACTATATAGATAATATTTTAATTGCTAGA
GAAACGTTCAAATACACAGATACTGGCTCTGTTGGGCTTATGACAGATGATTATAGGCTT
CTTTATTTACAAGCTAGTGGTTCAGTTTATACAAATAACGATCGATACACCCCACTAGAA
TTCTCTCATTATTTCCTGAAAGAAATGTTCACAGAAATTATGGGCTTTGAAAAATTTTAC
ATTGTAAGAGCGCAAGGAACGGCTTTGTATTCAGCAGATGAAGTATTAAAGTTTTTGCCA
GAAGAAATGGAAGCCACGGTGAATCAGTTTTATGATTAA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)