English site

CDS : MASE_10465

CDS Description

CDSMASE_10465
Product name(acyl-carrier-protein) phosphodiesterase
Gene name
ContigCP003841
location2451351..2451953
NBRC No.102226
MicrobeAlteromonas macleodii
Current status
>MASE_10465 (acyl-carrier-protein) phosphodiesterase
MKKVLAIFSSLNGNQGNSSKLANEYLSKIENDGSVHINRVDVASLALPHLTGEEMQAWMT
EASERNESQQALAKVSDDIVEAVKAADEIVLAVPMYNFGIPSSLKAYFDRIARAGITFKY
TETGPVGLLENKSATVFAARGGVYAGSDFDTQTPYLKHFLNFVGISDVKFVYAEGLNMGE
EQANKAFSEASEKIIELTNN


>MASE_10465 (acyl-carrier-protein) phosphodiesterase
ATGAAAAAAGTACTGGCTATATTTTCCAGCCTAAATGGCAACCAAGGTAATTCTTCAAAG
CTTGCAAACGAGTACCTTTCAAAAATTGAGAATGACGGTTCTGTGCACATTAACCGCGTG
GATGTTGCCTCTCTGGCACTGCCTCATTTAACAGGTGAAGAAATGCAAGCGTGGATGACT
GAGGCGTCTGAGCGAAATGAATCACAACAGGCATTGGCAAAAGTCTCTGATGACATTGTT
GAAGCAGTAAAAGCGGCTGACGAAATTGTGCTAGCCGTGCCAATGTACAACTTTGGCATC
CCATCGAGCTTAAAAGCTTACTTCGACCGTATTGCAAGAGCTGGTATAACATTCAAGTAT
ACCGAGACAGGTCCTGTCGGATTGCTAGAAAATAAATCAGCGACTGTTTTTGCCGCGCGT
GGTGGTGTGTATGCAGGTTCAGACTTTGATACGCAAACGCCGTATTTAAAACACTTTTTA
AATTTTGTTGGTATCAGTGACGTTAAATTCGTTTACGCTGAAGGACTTAACATGGGCGAA
GAGCAAGCAAACAAGGCTTTTTCTGAAGCAAGCGAAAAAATTATTGAACTAACCAACAAC
TAA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)