English site

CDS : MHO_0860

CDS Description

CDSMHO_0860
Product nameAcyl carrier protein phosphodiesterase
Gene name
ContigFP236530
location113123..113716
NBRC No.14850
MicrobeMycoplasma hominis
Current status
>MHO_0860 Acyl carrier protein phosphodiesterase
MAKVLIIYGSVIPRENSISTKMLDLFVDEYKRNNINDEIKILDLNNEDMYSLTDKNFKLF
YSEENSDKYINLLKSVDKVVMNAPMINFNIPTIIKAFFDRIAVANKTFSYKYASKGSSIG
LLNNLKVQIIATQGAPLG*YP*ASHINYLEGM*KFLGANLSESILLAGTKVEPLNKMQPH
EMVETISKEIIKKASIF


>MHO_0860 Acyl carrier protein phosphodiesterase
ATGGCAAAAGTATTAATAATATATGGTTCAGTTATACCAAGAGAAAATTCAATTTCAACA
AAAATGTTAGATCTTTTTGTTGATGAATATAAAAGAAATAATATTAATGATGAAATAAAA
ATTCTTGATTTAAATAATGAAGATATGTATTCATTAACTGACAAGAATTTTAAATTGTTT
TATAGTGAAGAAAACTCTGACAAATATATAAATTTATTGAAGTCTGTTGATAAAGTTGTT
ATGAATGCGCCGATGATAAACTTCAATATTCCAACTATAATCAAGGCATTTTTTGACCGT
ATTGCAGTTGCAAATAAAACATTTTCATATAAATACGCAAGCAAAGGTTCTTCAATTGGT
TTATTGAATAATTTAAAAGTTCAAATAATTGCAACGCAAGGAGCTCCATTAGGTTGATAT
CCATGAGCAAGTCATATTAATTATCTTGAAGGAATGTGAAAGTTTTTAGGTGCAAATCTT
TCAGAAAGCATTTTATTAGCTGGCACAAAAGTTGAACCTTTAAATAAAATGCAACCTCAT
GAAATGGTTGAAACTATTAGTAAAGAAATTATTAAAAAAGCAAGCATATTTTAA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)