English site

CDS : Mfl046

CDS Description

CDSMfl046
Product nameacyl carrier protein phosphodiesterase
Gene name
ContigAE017263
location61953..62552
NBRC No.100688
MicrobeMesoplasma florum
Current status
>Mfl046 acyl carrier protein phosphodiesterase
MSKLLVINGSVIPSDKSNSHEMARIFLEEYKKVNPNDEIIELDLNKLVVGTNVLTTETFS
TY*GEEEGMKYINQLKDVDKLLVIAPMYNFHVSGMLKNYIDHVALANQTFSYKYATKGAS
IGLLDKLKVQILATQGAPKG*YP*GDHVAYLKGT*EFMGAKVAEPILLAGVKVEPLSTQS
PKEIVSSITSDLIAAAKKF


>Mfl046 acyl carrier protein phosphodiesterase
ATGAGTAAATTATTAGTTATAAATGGTTCTGTTATTCCAAGTGATAAATCAAATTCACAC
GAAATGGCAAGAATATTTTTAGAGGAATACAAAAAAGTTAATCCAAATGACGAGATTATT
GAATTAGATTTAAATAAACTTGTTGTCGGAACAAATGTTTTAACAACTGAAACTTTTTCA
ACTTATTGAGGTGAAGAAGAAGGAATGAAATATATTAATCAATTAAAAGATGTTGATAAA
TTATTAGTTATCGCTCCAATGTATAACTTCCATGTTTCTGGAATGTTAAAAAACTATATT
GACCATGTTGCTTTAGCTAACCAAACTTTTTCTTATAAATACGCAACAAAGGGTGCAAGC
ATTGGTTTATTAGATAAACTTAAAGTTCAAATACTTGCTACTCAAGGAGCTCCAAAAGGT
TGATACCCATGAGGAGATCATGTAGCATATTTAAAAGGTACATGAGAATTTATGGGGGCA
AAAGTTGCTGAACCTATTTTATTAGCTGGTGTTAAGGTTGAACCACTAAGTACTCAATCT
CCAAAAGAAATTGTTTCATCAATAACTTCTGATTTGATTGCTGCTGCTAAGAAATTTTAA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)