English site

CDS : Minf_1829

CDS Description

CDSMinf_1829
Product nameAcyl carrier protein phosphodiesterase
Gene nameacpD
ContigCP000975
location1709104..1709733
NBRC No.Not assigned
MicrobeMethylacidiphilum infernorum
Current status
>Minf_1829 Acyl carrier protein phosphodiesterase
MGEKMSKILYIEASPRKDRSFSIAATQAFLQKYKEKHPQDVVELLDLWAKDLPRFDGYVL
ESKYALFHGLEHTPEQKRAWKAVEEIIGHFISFDKYIFSLPMWNFGIPYKLKHYIDILVQ
PTYTFSYSPQEGYKGLVLGKKACLVCARGGTYQDELQKLDFQLPYLKLILGFIGISEIHQ
VIVEGTLFQKRDELLFKATREAQRVAEIF


>Minf_1829 Acyl carrier protein phosphodiesterase
ATGGGGGAAAAGATGTCCAAGATATTGTATATCGAAGCTTCTCCAAGGAAAGATCGGTCT
TTTTCTATAGCCGCTACACAAGCCTTTCTTCAAAAATACAAGGAAAAGCATCCGCAAGAT
GTTGTTGAATTATTGGATCTTTGGGCTAAGGATTTACCGCGGTTTGATGGATATGTGCTT
GAAAGCAAATACGCCCTTTTTCATGGGCTGGAACATACTCCAGAGCAAAAAAGGGCATGG
AAAGCGGTGGAAGAGATCATCGGTCATTTTATATCCTTTGATAAATATATTTTTTCCCTG
CCCATGTGGAATTTCGGAATTCCCTATAAACTGAAACATTATATCGATATCCTCGTTCAG
CCTACCTATACCTTTTCTTATTCTCCGCAGGAAGGGTACAAGGGGCTTGTTTTGGGAAAA
AAAGCCTGCCTGGTCTGTGCCAGGGGGGGAACTTACCAGGATGAACTCCAAAAACTTGAT
TTCCAACTTCCCTATCTTAAGCTTATCCTTGGATTTATCGGCATTAGTGAAATTCACCAA
GTGATTGTCGAGGGAACTCTTTTTCAAAAAAGAGATGAGCTTTTATTCAAAGCTACCCGG
GAAGCCCAAAGGGTAGCGGAAATCTTTTAA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)