English site

CDS : NGR_c11680

CDS Description

CDSNGR_c11680
Product nameputative acyl carrier protein phosphodiesterase
Gene name
ContigCP001389
location1219436..1220056
NBRC No.101917
MicrobeRhizobium sp.
Current status
>NGR_c11680 putative acyl carrier protein phosphodiesterase
MNVLHIDSGILGEHSVSRRLTAAIVAQIKADRPDANVIYRDLVSERLQHLTGAQIMAPAD
LDGVDPALASDVRTGRQMLDEFLAADTIVVGAPMYNFSIPSQLKAWIDRLAVAGKTFRYT
EAGPEGLAKGKKVIVASTRGGHYSAGPAAAMDHQEAYLRTVFGFFGITDVEFVRAEGLNL
GADQKQFAIAEAEKTIAEGDVLRLAS


>NGR_c11680 putative acyl carrier protein phosphodiesterase
ATGAACGTCCTCCACATCGACTCCGGCATCCTCGGAGAACATTCGGTTTCCCGCCGCCTG
ACGGCGGCAATCGTCGCGCAGATCAAGGCTGACCGGCCCGATGCGAATGTGATCTACCGC
GACCTCGTCTCCGAGCGCCTGCAGCATCTGACCGGCGCGCAGATCATGGCGCCGGCCGAC
CTCGACGGTGTCGATCCGGCGCTGGCTTCGGATGTCCGGACCGGCCGCCAGATGCTCGAT
GAGTTCCTTGCCGCCGACACGATCGTCGTCGGCGCGCCGATGTACAACTTCTCGATTCCG
AGCCAGCTGAAAGCCTGGATCGATCGCCTTGCCGTCGCCGGCAAGACCTTCCGCTACACC
GAAGCCGGCCCGGAGGGTCTCGCCAAGGGCAAGAAGGTCATCGTCGCCTCGACGCGCGGT
GGACATTATTCTGCCGGGCCGGCCGCGGCCATGGATCACCAGGAAGCCTATTTGCGCACG
GTCTTCGGCTTCTTCGGTATCACCGATGTCGAATTCGTCCGTGCCGAAGGCCTGAACCTG
GGTGCAGACCAGAAGCAGTTCGCCATTGCCGAAGCTGAAAAGACGATCGCTGAGGGCGAC
GTTCTGCGGCTCGCGAGCTAA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)