English site

CDS : RHE_CH01764

CDS Description

CDSRHE_CH01764
Product name[acyl-carrier-protein] phosphodiesterase protein
Gene nameacpD
ContigCP000133
location1850596..1851210
NBRC No.15573
MicrobeRhizobium etli
Current status
>RHE_CH01764 [acyl-carrier-protein] phosphodiesterase protein
MSSILLLTSSPRAESLSTPIAADLAEKLKNQKPGSVVVRRDLAATPLPHIDDLFTGAIRK
PAEARTAEEIAAVKTSDELVAELFAADTIVISTGLINFNIYSSLKTWIDNVARAGVTFKY
TESGPVGLVTGKKVYVVLASGGVYSQGPAAPLNHAVPYLKSVLGFLGITDIETIYVEGLA
FGPEAAEKAIGAAKSRVEEIALAA


>RHE_CH01764 [acyl-carrier-protein] phosphodiesterase protein
ATGTCGTCCATTCTTCTTCTGACGTCCAGCCCGCGTGCCGAATCGCTCTCGACGCCAATC
GCCGCCGACCTCGCCGAGAAGCTGAAAAACCAGAAGCCGGGCAGCGTCGTCGTCCGTCGC
GACCTTGCCGCCACCCCGCTGCCGCATATCGACGACCTCTTCACCGGCGCGATCCGCAAG
CCGGCGGAAGCCCGCACCGCCGAAGAGATCGCAGCCGTCAAGACCTCCGACGAACTGGTC
GCCGAACTGTTTGCCGCCGACACGATCGTCATCAGCACCGGCCTGATCAACTTCAACATC
TATTCGTCGCTGAAGACCTGGATCGACAATGTCGCCCGCGCCGGTGTGACCTTCAAATAC
ACGGAAAGCGGCCCGGTCGGCCTCGTAACCGGCAAGAAAGTTTATGTGGTGCTTGCTTCC
GGCGGCGTCTACTCGCAGGGACCGGCTGCCCCCCTGAACCATGCCGTGCCTTACCTGAAG
TCGGTTCTCGGCTTCCTCGGCATCACCGACATCGAAACCATCTATGTCGAAGGCCTGGCT
TTTGGCCCCGAAGCCGCTGAAAAGGCCATCGGCGCCGCCAAGTCGCGCGTCGAGGAAATC
GCACTCGCAGCCTGA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)