English site

CDS : RHE_PC00047

CDS Description

CDSRHE_PC00047
Product nameprobable [acyl-carrier-protein] phosphodiesterase protein
Gene name
ContigCP000136
location44911..45531
NBRC No.15573
MicrobeRhizobium etli
Current status
>RHE_PC00047 probable [acyl-carrier-protein] phosphodiesterase protein
MTNILIVTSSPRGPEGLSTRFATEIAEGLKTALGGTLSRRDLAANPPPHIAQAYIGGRVV
GPETRTPEQAKAVGLAQELVDEVTAADVIVLGSGMINFGPSSQLKAWFDHITWPGVTFGY
SAAGKPQGLLTGKKVYLVTASGGVFSEGDWAAFDFQTGYLRHLLSFIGLTDIQIIRVEGT
VFGPEAAKAAIAATEAQVRAVLEKAA


>RHE_PC00047 probable [acyl-carrier-protein] phosphodiesterase protein
ATGACCAACATCCTCATCGTCACATCGAGCCCTCGTGGCCCGGAAGGTCTATCCACCCGG
TTTGCGACCGAGATCGCCGAAGGCCTGAAGACTGCGCTGGGCGGCACCCTTTCAAGGCGT
GATCTGGCAGCCAACCCACCGCCGCATATCGCGCAAGCCTATATTGGCGGCCGCGTCGTT
GGGCCCGAGACCCGCACCCCCGAACAGGCCAAGGCGGTCGGCCTTGCCCAGGAGCTGGTC
GACGAGGTGACGGCGGCTGACGTGATCGTCCTGGGTTCGGGCATGATCAATTTCGGCCCG
TCGTCGCAGCTGAAGGCCTGGTTCGATCATATCACCTGGCCGGGCGTGACCTTCGGTTAC
AGCGCAGCCGGCAAGCCGCAGGGATTGCTGACCGGCAAGAAGGTGTATCTGGTCACTGCC
TCAGGCGGGGTCTTCTCCGAAGGTGACTGGGCCGCCTTCGATTTCCAGACCGGCTATCTG
CGCCACCTCCTCAGCTTCATTGGCCTGACAGACATCCAAATTATCCGCGTGGAAGGCACC
GTCTTCGGTCCCGAGGCGGCCAAGGCTGCCATAGCAGCCACCGAAGCCCAGGTTCGCGCG
GTGTTGGAAAAGGCCGCCTGA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)