English site

CDS : Rahaq2_2249

CDS Description

CDSRahaq2_2249
Product nameacyl carrier protein phosphodiesterase
Gene name
ContigCP003244
location2388393..2389010
NBRC No.105701
MicrobeRahnella aquatilis
Current statusFinished
>Rahaq2_2249 acyl carrier protein phosphodiesterase
MSKVLVLKSSILANFSQSNQLADYLVAQYQSANSGSSVTVRDLAADPIPVLDGELVGALR
PSDAPLTPRQEEALALSNTLIEELQAHDVIVIAAPMYNFNIPTQLKNYFDLVARAGVTFK
YTEKGPEGLVKGKRVIVLTSRGGIHKDTPSDLVAPYLSLFLGFLGMSDVEFVYAEGIAYG
PEVATKAQTDAKAAIDAAIKELSAA


>Rahaq2_2249 acyl carrier protein phosphodiesterase
ATGAGCAAAGTACTCGTCCTGAAATCAAGCATTCTGGCTAACTTCTCTCAGTCAAATCAA
CTGGCCGATTATCTGGTTGCCCAGTATCAGTCTGCAAACAGCGGTTCTTCTGTGACAGTT
CGTGACCTGGCGGCTGATCCGATCCCTGTACTTGACGGTGAACTGGTGGGCGCACTGCGT
CCATCCGATGCTCCGCTGACACCACGTCAGGAAGAAGCCCTGGCGCTGTCCAACACCCTG
ATTGAAGAACTGCAGGCGCATGACGTGATTGTTATCGCGGCACCTATGTACAACTTCAAC
ATTCCTACCCAGTTGAAAAACTATTTCGACCTGGTTGCCCGTGCTGGTGTGACCTTCAAA
TACACCGAGAAAGGCCCTGAAGGTCTGGTGAAAGGCAAACGCGTTATCGTTCTGACCAGC
CGTGGTGGTATCCATAAAGACACCCCGAGCGACCTGGTTGCGCCATACCTGTCTCTGTTC
CTGGGCTTCCTGGGGATGAGCGACGTAGAATTCGTTTACGCGGAAGGCATCGCATACGGT
CCTGAAGTGGCGACGAAAGCACAGACCGATGCGAAAGCAGCCATCGATGCAGCCATTAAA
GAACTGTCTGCAGCATAA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)