English site

CDS : SAV4344

CDS Description

CDSSAV4344
Product namehypothetical protein
Gene name
ContigBA000030
location5322321..5322974
NBRC No.14893
MicrobeStreptomyces avermitilis
Current status
>SAV4344 hypothetical protein
MATLLHIDSSVFPSAASASRAVAETFRTAWQEQHPDGTVIYRDLSANPVPHITADAHTAG
FADPATHTPGQAAAFAEREKLIAELEQADAVLIGAPMYNYAIPSTLKAWLDNVILMGRTA
ANENSKVTGTPVTVIASRGGSYAPGTPREPYEYVQNYLKAVLSDALGLELEFIVPELTMA
AHNPAMSELVPLAEASRAKAHEDAAAKAKELADRFAA


>SAV4344 hypothetical protein
ATGGCCACCCTTCTCCACATCGACTCGTCCGTGTTCCCGAGCGCGGCGTCCGCGTCGCGC
GCCGTCGCGGAGACCTTCCGCACGGCATGGCAGGAGCAGCACCCGGACGGCACGGTGATC
TACCGCGACCTCTCCGCGAACCCGGTGCCACACATCACCGCCGACGCCCACACCGCCGGT
TTCGCCGACCCGGCCACCCACACCCCCGGGCAGGCCGCCGCGTTCGCCGAGCGCGAGAAG
CTCATCGCGGAGCTGGAGCAGGCCGACGCGGTCCTGATCGGCGCACCGATGTACAACTAC
GCGATCCCGTCGACGCTCAAGGCGTGGCTGGACAACGTGATCCTCATGGGCCGCACCGCC
GCGAACGAGAACTCGAAGGTGACGGGCACCCCGGTAACGGTCATCGCCAGCCGCGGCGGC
TCGTACGCGCCGGGCACCCCGCGTGAGCCCTACGAGTACGTGCAGAACTACCTGAAGGCC
GTCCTGAGCGACGCGCTCGGCCTCGAACTGGAGTTCATCGTTCCTGAGCTCACGATGGCG
GCGCACAACCCGGCGATGTCCGAGCTGGTCCCGCTCGCCGAGGCCTCCCGCGCCAAGGCC
CACGAGGACGCCGCCGCGAAGGCCAAGGAACTCGCGGACCGCTTCGCCGCCTGA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)