English site

CDS : SE_0330

CDS Description

CDSSE_0330
Product nameconserved hypothetical protein
Gene name
ContigAE015929
location331090..331656
NBRC No.12993
MicrobeStaphylococcus epidermidis
Current status
>SE_0330 conserved hypothetical protein
MKGLIIIGSAQVGSHTNALSKYLKGQLGEHDVEVEIFDLAEKPIHQLDFAGTTQAVDEIK
NNVKSLQNKAMEADFLILGTPNYHGSFSGILKNALDHLNMDHFKMKPVGLICNSGGIVSS
EPLSHLRVIVRSLLGIAVPTQIATHDSDYAKLEDGTLYLEDNEFQLRSKLFVDQIVSFVT
NSPYEHLK


>SE_0330 conserved hypothetical protein
ATGAAAGGTTTAATTATTATAGGGAGTGCTCAAGTAGGGTCTCATACGAACGCTTTATCA
AAATATTTAAAAGGTCAACTCGGTGAACATGATGTTGAGGTGGAAATCTTTGACCTAGCT
GAGAAACCCATTCATCAATTGGATTTTGCTGGTACAACACAAGCAGTTGATGAAATTAAA
AACAATGTCAAATCTTTACAAAATAAAGCAATGGAAGCAGATTTCTTAATTTTAGGAACG
CCAAATTATCATGGATCGTTTTCAGGTATTCTTAAAAATGCACTTGACCACCTTAATATG
GACCATTTCAAAATGAAACCCGTGGGACTCATTTGCAATAGTGGAGGAATAGTAAGTTCT
GAGCCATTATCACACTTGAGAGTCATCGTACGTAGTTTACTTGGTATTGCTGTACCAACG
CAAATTGCTACACATGATTCTGATTATGCTAAATTAGAAGATGGTACCTTATACTTAGAA
GATAATGAATTTCAACTACGTTCAAAATTGTTTGTTGATCAAATTGTATCCTTCGTAACA
AATAGTCCATATGAACACTTAAAATAA


Assigned Rule

Assigned RuleRelated Function
AZR (NRULE_0237)NADPH azoreductaseAromatic azo compounds degradation (NFUNC_0073)