English site

CDS : SSP2154

CDS Description

CDSSSP2154
Product nameconserved hypothetical protein
Gene name
ContigAP008934
location2215407..2215973
NBRC No.102446
MicrobeStaphylococcus saprophyticus subsp. saprophyticus
Current status
>SSP2154 conserved hypothetical protein
MKGLIIVGSAKVGSHTTALSQYLKGHFEEHDFDVEIFDLAEQPIHQLDVSGASNLSESYK
NNLQTLKTKAREADFFVLGSPNYHGSYSGILKNALDHLTMDDFKMKPVGLIGNSGGIVSS
EPLSHLRLIVRSLLGIAVPTQIATHDTDFKKLDDGTYYLANEEFQLRARLFVDQIISFVK
NSPYEHLK


>SSP2154 conserved hypothetical protein
ATGAAAGGTTTAATTATAGTTGGTAGTGCTAAAGTGGGGTCACATACAACAGCACTATCT
CAATATTTGAAAGGTCATTTTGAAGAACATGACTTTGATGTTGAAATTTTTGATTTGGCG
GAGCAACCTATCCACCAACTTGATGTTTCTGGAGCATCTAATCTAAGTGAAAGTTATAAA
AATAATTTACAAACATTGAAAACTAAAGCAAGAGAAGCTGATTTTTTCGTACTAGGTAGT
CCTAATTATCACGGTTCTTACTCAGGTATTTTAAAAAATGCTTTAGACCATTTAACAATG
GATGATTTTAAAATGAAACCAGTAGGATTAATAGGTAATAGTGGTGGTATTGTCAGTTCT
GAACCATTGTCACATTTACGTTTAATTGTACGTTCGCTATTAGGTATTGCAGTACCTACA
CAAATTGCTACACATGATACGGATTTTAAAAAATTAGACGATGGTACATATTATTTAGCT
AATGAAGAATTTCAATTACGTGCGCGTTTATTTGTAGATCAAATTATTTCATTTGTAAAA
AACAGTCCATATGAACATTTAAAATAA


Assigned Rule

Assigned RuleRelated Function
AZR (NRULE_0237)NADPH azoreductaseAromatic azo compounds degradation (NFUNC_0073)