English site

CDS : all2105

CDS Description

CDSall2105
Product nameacyl carrier protein phosphodiesterase
Gene nameacpD
ContigBA000019
location2524079..2524702
NBRC No.Not assigned
MicrobeNostoc sp.
Current status
>all2105 acyl carrier protein phosphodiesterase
MANILHIDSSPRGDRSISRKLSYEFITSWKDTHPGDTVTYRDLGHNPVPHVDEPWIAAAF
SSPESHTPELKTAIELSDTLIDEFLAADRLVFGVPMYNLNIPSTFKAYIDQIVRAGKTFT
VDANGYKGLVDSSKKVLIITSRGGSYPPGTPYAAYDYQEPYLRAILGFMGLTDVTFIHAE
SLNMGEDAREKSLAGAKDAIAQAVANW


>all2105 acyl carrier protein phosphodiesterase
ATGGCAAATATCCTCCATATTGATTCTAGCCCTCGTGGCGATCGCTCTATATCCCGTAAA
CTCTCTTACGAGTTCATCACATCTTGGAAAGATACCCATCCTGGTGATACCGTAACTTAC
CGGGATTTAGGTCACAACCCTGTTCCCCATGTAGATGAACCCTGGATTGCGGCGGCGTTT
TCTTCACCAGAATCACACACCCCTGAGCTAAAAACAGCAATAGAGCTGTCTGATACCCTC
ATTGATGAATTTCTCGCCGCCGATCGCTTGGTTTTTGGCGTACCGATGTATAACTTAAAT
ATACCTTCGACTTTCAAGGCGTATATCGACCAAATAGTTCGTGCAGGCAAAACCTTTACT
GTTGATGCAAACGGCTATAAAGGTTTAGTTGATAGCAGCAAAAAAGTACTGATTATTACA
TCCCGTGGTGGTAGTTATCCACCAGGAACACCCTATGCAGCCTATGACTATCAAGAACCT
TATCTCCGTGCTATCTTAGGGTTCATGGGACTAACAGATGTTACCTTCATCCATGCTGAG
TCCTTGAACATGGGCGAAGATGCTCGTGAAAAATCTCTCGCAGGTGCGAAAGATGCGATC
GCTCAAGCTGTAGCTAACTGGTAG


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)