English site

CDS : EAE_01360

CDS Description

CDSEAE_01360
Product nameacyl carrier protein phosphodiesterase
Gene name
ContigCP002824
location285669..286274
NBRC No.13534
MicrobeEnterobacter aerogenes
Current status
>EAE_01360 acyl carrier protein phosphodiesterase
MSNVLILKSSINGPASLTNQLIDEYMQTRRDAGHQDSVVEHDLTTLALPKLDGALFAALR
GAQDSRPAIQQGVALSDSLIGELKASDLLVIGAPMYNLNVPTDLKNWFDLVARARETFRY
TETWPQGLVEGVRAVVISSRGGVHDGQPSDAVTPYLRAVLGLMGISDVEFIYAEGMDIRP
HGRDAGIAHARQHIARAAQQA


>EAE_01360 acyl carrier protein phosphodiesterase
ATGAGTAACGTTTTGATTTTAAAATCCAGCATCAACGGCCCGGCGTCGCTAACCAACCAG
CTAATAGATGAATATATGCAGACCCGCCGCGATGCCGGTCATCAGGATTCGGTCGTCGAA
CACGATCTGACCACCCTCGCCTTGCCGAAACTCGACGGCGCGCTGTTTGCCGCGTTGCGC
GGCGCGCAAGACTCGCGCCCGGCGATTCAGCAAGGGGTTGCCCTCTCTGACTCACTCATC
GGCGAGTTAAAGGCCAGCGATCTGCTGGTGATCGGCGCGCCGATGTATAACCTCAACGTG
CCAACCGATCTCAAAAACTGGTTCGATCTGGTGGCGCGGGCGCGGGAAACCTTCCGCTAC
ACCGAGACCTGGCCTCAGGGACTAGTGGAAGGCGTGCGTGCGGTGGTCATTAGTTCGCGC
GGCGGCGTCCATGACGGGCAACCCAGCGATGCGGTCACCCCTTACCTGCGCGCGGTGCTG
GGATTGATGGGGATTAGCGACGTTGAATTTATCTATGCTGAAGGGATGGATATTCGCCCG
CACGGCCGCGACGCGGGCATTGCCCACGCCCGCCAGCATATCGCCAGGGCCGCTCAGCAG
GCGTGA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)