English site

CDS : HMPREF0204_11428

CDS Description

CDSHMPREF0204_11428
Product nameflavodoxin-like protein
Gene name
ContigACKQ02000004
location204021..204629
NBRC No.15054
MicrobeChryseobacterium gleum
Current statusImproved High-Quality Draft
>HMPREF0204_11428 flavodoxin-like protein
MKNILHIISSARGEKSYSNQLSSAILEKLLQKGNINKITLRNLVKDAPPYADEVSIHEFY
KHPELYDEQSGQLLSYANLIVDEVREADIIVIGTPVFNLGISTPLKAWLDQLIRVGITYV
FDEQWNRVGQLKGKKVYLAVASGGRSAEGSPDYISAYLADVFRSYAGITDVETYRIEGTM
ENGFTADYESILKDFNSVNEML


>HMPREF0204_11428 flavodoxin-like protein
ATGAAGAATATTCTGCACATTATCTCCAGCGCAAGAGGAGAAAAGTCTTATAGTAACCAG
CTAAGCTCAGCCATTCTGGAAAAACTGTTACAAAAAGGTAACATCAACAAGATTACTCTA
CGAAACTTAGTTAAAGATGCCCCTCCATATGCAGATGAAGTGTCCATTCATGAGTTTTAT
AAACACCCTGAATTATACGATGAACAAAGCGGGCAGCTTCTTTCGTATGCCAATCTGATT
GTGGATGAAGTGCGTGAAGCGGATATTATTGTCATTGGAACACCGGTTTTCAACCTTGGA
ATTTCCACACCTCTGAAAGCCTGGCTTGACCAGCTGATCCGCGTAGGAATTACTTATGTT
TTTGATGAACAATGGAATCGCGTGGGCCAGCTTAAAGGGAAAAAAGTATATCTTGCTGTT
GCTTCCGGTGGCAGAAGTGCTGAAGGTTCACCGGATTATATTTCAGCTTATCTTGCGGAT
GTTTTCAGAAGTTATGCAGGAATTACGGACGTAGAAACTTACCGCATTGAGGGAACTATG
GAAAACGGTTTTACAGCGGATTATGAAAGTATTTTGAAAGATTTTAATTCCGTCAATGAA
ATGCTTTAA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)