English site

CDS : HMPREF0204_13370

CDS Description

CDSHMPREF0204_13370
Product nameflavodoxin-like protein
Gene name
ContigACKQ02000007
location1476953..1477555
NBRC No.15054
MicrobeChryseobacterium gleum
Current statusImproved High-Quality Draft
>HMPREF0204_13370 flavodoxin-like protein
MKRVLHITSSPRSESSVSKKLGNAVVEKITAKYPDHILKKRDLANPLFPHLEEAHINAFF
TPAENRTSEQSEIVKLSDTVIDELQEADIIVIEAPLYNFSITSTLKSWLDHIARAGKTFS
YSENGPEGLVKNKKVYLAFSSGGVYSEGERQAYDFVIPYLEKTLGFMGMTDISVVRAEGL
SVPVVQETALQKGIESIIVE


>HMPREF0204_13370 flavodoxin-like protein
ATGAAACGAGTACTTCATATTACTTCAAGTCCGAGAAGTGAATCATCAGTGAGTAAAAAA
CTGGGAAATGCAGTCGTAGAGAAAATAACAGCCAAGTATCCTGACCATATTTTAAAAAAA
CGCGATCTGGCAAATCCCCTTTTTCCTCATTTGGAAGAAGCGCATATCAATGCATTCTTT
ACGCCGGCTGAAAACCGGACTTCTGAACAGTCGGAAATTGTAAAGCTTTCAGATACGGTA
ATTGATGAGCTTCAGGAAGCTGATATTATTGTTATTGAAGCGCCCCTGTACAATTTCAGC
ATCACTTCCACACTGAAATCATGGCTTGATCATATTGCCAGAGCAGGAAAAACATTCAGC
TACAGCGAAAACGGTCCTGAAGGCCTGGTGAAAAATAAAAAAGTATACCTTGCCTTTTCA
AGTGGCGGCGTATATTCTGAAGGGGAAAGACAGGCTTACGACTTCGTAATTCCTTACTTG
GAAAAAACGCTTGGATTTATGGGAATGACGGATATTTCTGTTGTCCGTGCAGAAGGACTT
TCTGTTCCGGTCGTTCAGGAAACAGCCCTGCAAAAAGGGATTGAAAGTATTATTGTAGAA
TAA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)