English site

CDS : HMPREF9088_0350

CDS Description

CDSHMPREF9088_0350
Product nameflavodoxin-like protein
Gene name
ContigAEPV01000012
location25928..26545
NBRC No.107825
MicrobeEnterococcus italicus
Current statusStandard Draft
>HMPREF9088_0350 flavodoxin-like protein
MKNVLVVKANNRPDGVSTAMFNKFVENLDASKVEVDTFDVYAQEMPYIGQTLFDAFGKLA
AGEPFSSDEQKLMDVRQVVQDKFSKADVVVFAFPMWNLTIPAALHTFIDYIFQAGYTFSY
NEDGSMNQLQAGKEVILLNARGGVYSGEGAAMETAVSYMQKTFGAMFGMNIIEEVIIEGH
NADPSRTQEIIAAGLDRVAEAAKAL


>HMPREF9088_0350 flavodoxin-like protein
ATGAAAAACGTTTTAGTTGTCAAAGCAAATAACCGTCCAGACGGCGTTTCAACAGCAATG
TTCAATAAATTTGTTGAAAACTTGGATGCATCTAAAGTTGAAGTTGATACATTTGATGTC
TACGCACAAGAAATGCCATATATCGGTCAAACATTATTTGACGCATTTGGTAAATTAGCT
GCTGGTGAACCTTTCTCTAGCGACGAACAAAAATTAATGGACGTTCGCCAAGTAGTGCAA
GATAAATTTTCTAAAGCAGACGTAGTTGTTTTTGCTTTCCCAATGTGGAACTTAACAATT
CCAGCTGCTTTGCATACATTCATCGACTACATCTTCCAAGCTGGTTACACTTTCTCATAC
AACGAAGATGGATCAATGAACCAACTACAAGCTGGTAAAGAAGTAATCTTACTTAATGCT
CGTGGCGGTGTCTACTCTGGTGAAGGTGCTGCGATGGAAACTGCTGTATCTTACATGCAA
AAAACATTCGGTGCAATGTTTGGCATGAACATCATCGAAGAAGTAATCATTGAAGGTCAC
AATGCAGACCCTTCAAGAACACAAGAAATTATCGCTGCTGGCTTAGACCGCGTAGCTGAG
GCTGCTAAAGCTTTATAA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)