English site

CDS : KT71_17636

CDS Description

CDSKT71_17636
Product nameAcyl carrier protein phosphodiesterase
Gene name
ContigAAOA02000001
location209508..210104
NBRC No.104960
MicrobeCongregibacter litoralis
Current status
>KT71_17636 Acyl carrier protein phosphodiesterase
MTVLKIDSSARVEGANSRIVTDYLVQQLGQPVIERDLVKSPLPPMSPQDLVGVHGSHKAD
RASLQQHLAMSNKLIAELQQADTLVLGVAMYNFSVPLYLKQWIDYVCRAGVSFRYTENGP
EGLTGVKRAFIVTASGGTPIGGDWDFASRYMEHICRFLGINEVVHIDASGSKGSPEVVIA
AARQQIDAMLAQPEVEEA


>KT71_17636 Acyl carrier protein phosphodiesterase
ATGACCGTATTGAAAATTGATTCCAGCGCCCGGGTGGAGGGCGCTAACTCGCGCATCGTT
ACTGATTATTTGGTGCAACAACTGGGGCAGCCGGTCATCGAACGGGACCTGGTTAAGAGC
CCTTTGCCGCCGATGAGTCCGCAGGATCTGGTAGGTGTGCACGGCTCACACAAGGCTGAC
CGTGCCAGCTTGCAGCAGCATCTGGCGATGTCCAATAAATTGATCGCCGAATTGCAGCAA
GCCGACACCCTGGTGCTGGGCGTGGCAATGTACAACTTTAGTGTTCCCCTCTACCTGAAA
CAGTGGATCGACTATGTCTGTCGCGCCGGGGTTTCATTCCGCTACACAGAGAACGGCCCG
GAAGGGCTCACCGGTGTGAAGCGAGCCTTTATTGTAACGGCTTCCGGCGGCACGCCAATT
GGCGGTGACTGGGATTTTGCCAGCCGCTATATGGAGCACATCTGTCGCTTTCTGGGCATC
AATGAGGTGGTTCATATCGATGCCAGCGGCTCCAAGGGCTCCCCGGAGGTGGTGATAGCA
GCGGCCCGGCAGCAGATTGATGCAATGTTGGCGCAGCCCGAAGTAGAGGAGGCCTGA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)