English site

CDS : PROVALCAL_00369

CDS Description

CDSPROVALCAL_00369
Product nameflavodoxin-like protein
Gene name
ContigABXW01000004
location289428..290027
NBRC No.105687
MicrobeProvidencia alcalifaciens
Current status
>PROVALCAL_00369 flavodoxin-like protein
MKILVIKSSINGAASQTNTLIQQYLDERKAQGYQDCIIEHDVAEKPLPVLNQARFAALRG
AEINNHNLKNTAELSDQLIAELKESDLLILGAPMYNLNVPTELKNWFDLVVRARETFRYT
ATYPLGLVENVKALVFSARGGIHYGQETDAITPYLKSVLGLMGITDVQFIYAEGLDMKPE
GYEAGIAKAQQQLMHHVHC


>PROVALCAL_00369 flavodoxin-like protein
ATGAAAATCTTAGTTATAAAATCCAGTATTAATGGTGCAGCATCTCAAACAAATACCTTA
ATTCAACAGTATCTGGATGAACGTAAAGCCCAAGGATATCAAGATTGTATTATCGAACAT
GATGTGGCAGAAAAACCCTTACCAGTACTGAATCAAGCGCGTTTTGCTGCACTAAGAGGT
GCAGAGATTAACAATCATAATTTAAAAAATACAGCCGAACTTTCAGACCAGTTAATTGCG
GAATTAAAAGAGAGTGATTTACTGATCCTCGGTGCACCAATGTATAACCTCAACGTACCG
ACTGAATTAAAAAATTGGTTTGATTTAGTCGTCAGAGCAAGAGAAACATTCCGCTATACA
GCAACCTACCCGCTGGGCTTAGTGGAAAATGTTAAAGCACTGGTATTTAGTGCTCGGGGA
GGCATTCACTATGGGCAAGAAACCGATGCAATTACACCTTATTTGAAATCCGTTTTAGGT
TTAATGGGCATTACAGATGTTCAGTTTATCTATGCTGAGGGTTTGGATATGAAACCCGAA
GGGTATGAAGCGGGAATAGCTAAAGCTCAACAACAATTAATGCATCATGTTCATTGTTAA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)