English site

CDS : SIAM614_19776

CDS Description

CDSSIAM614_19776
Product nameAcyl carrier protein phosphodiesterase
Gene name
ContigAAUW01000011
location116737..117336
NBRC No.16684
MicrobeLabrenzia aggregata
Current status
>SIAM614_19776 Acyl carrier protein phosphodiesterase
MSAPLKTILHINASARATGSVTRDLGQTFVTRLMAKSPDVEVIARDVSQGLPFLSEEWIG
ATVTDPAARSAEQKEALALSDTLVGELKAADTIVIGTPVYNFSVPAALKAWIDMIARARE
TFQYTENGAVGLLQGKKAYIIIASGGTKVGSEIDFAGTYLKHILGFIGISDVTIIAADQL
MIDPDNRDAALAQTLELAA


>SIAM614_19776 Acyl carrier protein phosphodiesterase
ATGTCCGCGCCGTTGAAAACAATCCTGCACATTAATGCCTCTGCTCGTGCCACCGGTTCG
GTGACGCGGGACCTTGGGCAGACCTTTGTGACACGTTTAATGGCAAAATCACCAGATGTT
GAAGTCATTGCTCGTGATGTTTCCCAGGGACTGCCTTTCCTCAGTGAAGAGTGGATCGGA
GCGACTGTTACAGATCCTGCTGCACGGAGCGCAGAACAGAAAGAGGCGCTTGCTTTGTCT
GACACGCTTGTTGGGGAATTAAAGGCAGCAGATACCATCGTGATTGGCACCCCTGTTTAC
AACTTCTCCGTTCCGGCGGCGCTAAAAGCGTGGATCGACATGATCGCGCGGGCAAGAGAG
ACGTTCCAGTATACGGAGAATGGAGCGGTTGGTCTGCTTCAGGGAAAAAAGGCCTATATC
ATCATTGCCTCCGGTGGCACCAAGGTAGGATCAGAGATCGACTTCGCCGGGACTTACCTG
AAGCATATTCTGGGCTTCATCGGAATTTCCGATGTGACGATTATTGCCGCCGATCAGTTG
ATGATTGACCCTGATAACCGGGACGCCGCACTGGCTCAGACATTGGAACTAGCCGCCTGA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)