English site

CDS : SIAM614_26623

CDS Description

CDSSIAM614_26623
Product name(Acyl-carrier protein) phosphodiesterase
Gene name
ContigAAUW01000013
location23112..23810
NBRC No.16684
MicrobeLabrenzia aggregata
Current status
>SIAM614_26623 (Acyl-carrier protein) phosphodiesterase
MNILQATVFFAHNRRNSLRTSSKSGDTRMTLLLRINSSSRQTGSHSTAIADHFEESYRRK
HPDCRVITRNVADGSIPIISQRTIEGFYTEPQCMTADLKQATALSDALIAELQEADTLLI
AAPIYNFSVPAALKAWIDQIVRVGHTFSYDGTSFQGLARTPRAVVISAYGAEGYLDGEPF
AAANFVQPYLKFLLSFLGVEDIRFIAVQGTIADPEKVSASLQAARQACDLAA


>SIAM614_26623 (Acyl-carrier protein) phosphodiesterase
ATGAATATCCTGCAAGCCACAGTATTTTTCGCGCACAATCGCAGAAATAGCCTGCGGACC
TCATCCAAATCCGGAGATACCCGCATGACACTGCTTCTGCGCATCAATTCCAGCTCCCGC
CAGACCGGCTCGCATTCCACCGCCATTGCCGATCATTTCGAGGAAAGCTACCGCCGCAAA
CACCCCGATTGCCGCGTCATCACGCGCAATGTTGCCGACGGCTCCATCCCGATCATCAGC
CAAAGGACCATCGAAGGCTTCTATACCGAGCCCCAATGCATGACGGCGGACCTGAAGCAG
GCAACGGCGCTCTCCGATGCGTTGATCGCAGAACTCCAGGAAGCCGACACCCTGCTGATT
GCCGCACCGATCTACAATTTCTCGGTTCCGGCGGCCCTCAAGGCCTGGATCGACCAGATC
GTTCGCGTCGGACACACGTTTTCCTATGACGGCACCAGTTTTCAGGGCCTTGCAAGAACC
CCGCGCGCCGTGGTGATCTCCGCCTATGGCGCTGAAGGCTATCTCGATGGCGAGCCCTTT
GCCGCCGCCAATTTCGTGCAGCCTTACCTCAAGTTCCTGTTGTCGTTCCTGGGCGTTGAA
GATATCCGCTTCATCGCCGTTCAGGGCACTATTGCCGATCCTGAAAAGGTCTCGGCCAGT
CTTCAGGCCGCCCGGCAGGCGTGCGACCTGGCCGCCTGA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)