English site

CDS : SIAM614_29186

CDS Description

CDSSIAM614_29186
Product nameputative [acyl-carrier-protein] phosphodiesterase
Gene name
ContigAAUW01000022
location66288..66887
NBRC No.16684
MicrobeLabrenzia aggregata
Current status
>SIAM614_29186 putative [acyl-carrier-protein] phosphodiesterase
VLGDASVSNQLTSHLVNQLRLKDGNAKVITRDLASNPVPHLTQESTIALRAAETENEAQA
TAQALSDELIAELKAADLIVMGAPMYNFGIPSTLKAWFDYVLRAGVTFSYSESGPEGLLK
GKRAIVVLTRGGLYSEGPAQLMDAQEPHLRTLLGFIGITDVTFVRAEKLAFGAEVQEQAI
ASAKKEVNDLVEGLYMAAA


>SIAM614_29186 putative [acyl-carrier-protein] phosphodiesterase
GTGCTCGGCGATGCTTCCGTGTCCAACCAGCTTACCTCTCACCTGGTCAATCAATTGCGT
CTCAAGGACGGCAACGCCAAGGTCATAACGCGCGATCTGGCAAGCAATCCTGTACCGCAT
CTGACACAGGAGTCCACGATTGCCTTGCGCGCAGCCGAAACAGAAAACGAAGCGCAGGCG
ACTGCGCAAGCGCTCTCCGACGAACTGATTGCCGAACTGAAGGCGGCTGATCTGATCGTC
ATGGGCGCGCCCATGTATAATTTCGGCATTCCGTCCACCTTGAAGGCCTGGTTCGATTAC
GTGCTGCGCGCTGGAGTAACCTTCTCCTACAGCGAATCCGGTCCGGAAGGGCTGCTGAAG
GGCAAGCGCGCCATCGTCGTGCTGACACGCGGAGGCCTTTACAGCGAAGGACCGGCGCAG
CTCATGGACGCTCAGGAACCGCATCTGCGCACCTTGCTGGGCTTCATCGGCATCACGGAC
GTTACCTTCGTTCGGGCAGAGAAACTTGCCTTCGGTGCGGAAGTCCAGGAACAGGCAATC
GCTTCTGCCAAGAAGGAAGTCAACGACCTGGTCGAAGGACTGTACATGGCGGCCGCCTGA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)