English site

CDS : blr5106

CDS Description

CDSblr5106
Product nameacyl-carrier-protein phosphodiesterase
Gene nameacpD
ContigBA000040
location5663040..5663648
NBRC No.14792
MicrobeBradyrhizobium diazoefficiens
Current status
>blr5106 acyl-carrier-protein phosphodiesterase
MKLLHIDSSVLGPHSVSRQVSAAIVDRLRQATPSLEVVYRDLTQTPLAHLSGSHLAAAQG
APAPAELGPDLAASAAVLNEFLAADVVVIGAPMYNFTIPSQLKAWIDRILVAGKTFQYGA
NGPQGLAGAKRVIVAISRGGYYGADMPTAAGEHLETYLRWVFGFIGITDPEFISADGIQV
GPDHREKALAGALQAATSLQAA


>blr5106 acyl-carrier-protein phosphodiesterase
ATGAAACTCCTCCATATCGACTCCAGCGTGCTCGGCCCCCACTCCGTCAGCCGGCAGGTT
TCCGCCGCCATCGTCGACCGTCTCCGCCAGGCGACGCCCTCACTCGAGGTCGTCTATCGC
GATCTGACCCAGACCCCGCTCGCCCACCTCTCCGGCTCGCATCTGGCGGCCGCGCAAGGC
GCGCCTGCGCCGGCGGAACTCGGACCCGACCTTGCCGCGAGCGCGGCCGTGCTGAACGAG
TTCCTCGCTGCCGACGTGGTCGTGATCGGCGCGCCCATGTACAATTTCACCATCCCGAGC
CAGCTCAAGGCCTGGATCGACCGCATCCTGGTGGCGGGGAAGACATTTCAATACGGCGCC
AATGGACCTCAGGGCCTTGCCGGCGCAAAGCGCGTGATCGTGGCGATCTCGCGCGGCGGC
TATTACGGCGCGGACATGCCGACTGCCGCTGGCGAGCATCTCGAAACCTATCTGCGCTGG
GTGTTCGGCTTCATCGGCATCACCGATCCCGAGTTCATCTCCGCCGACGGCATCCAGGTC
GGGCCGGATCATCGTGAGAAAGCGCTGGCCGGCGCACTTCAGGCGGCCACCAGCCTTCAG
GCGGCGTGA


Assigned Rule

Assigned RuleRelated Function
AZOR (NRULE_0236)FMN-dependent NADH-azoreductaseAromatic azo compounds degradation (NFUNC_0073)